Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Carbonic anhydrase 2 (Ca2)

Recombinant Rat Carbonic anhydrase 2 (Ca2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Carbonic anhydrase 2 (Ca2) . Accession Number: P27139; Ca2. Expression Region: 2-260aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 31.7kda. Target Synonyms: Carbonate dehydratase II; Carbonic anhydrase II; CA-II Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Carbonic anhydrase 2 (Ca2) is a purified Recombinant Protein.

Accession Number

P27139; Ca2

Expression Region

2-260aa

Host

E. coli

Target

Carbonic anhydrase 2 (Ca2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Carbonate dehydratase II; Carbonic anhydrase II; CA-II

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

SHHWGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVASKSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELMVDNWRPAQPLKNRKIKASFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Polyclonal Donkey anti-Rat IgG (H+L) Secondary Antibody [DyLight 488]
NBP1-72743G 0.5 mL

Donkey Polyclonal Donkey anti-Rat IgG (H+L) Secondary Antibody [DyLight 488]

Sign In for Pricing
View Details
SEZ6 Antibody - C-terminal region (ARP66090_P050)
ARP66090_P050 100 µL

SEZ6 Antibody - C-terminal region (ARP66090_P050)

Sign In for Pricing
View Details
UT14C Antibody
C47042-01 50 µL

UT14C Antibody

Sign In for Pricing
View Details
UT14C Antibody
C47042-02 100 µL

UT14C Antibody

Sign In for Pricing
View Details
Human Rho GTPase Activating Protein 21 ELISA Kit
ELA-E4373h 96 Tests

Human Rho GTPase Activating Protein 21 ELISA Kit

Sign In for Pricing
View Details
CRK Polyclonal Antibody
MBS2529318-01 0.02 mL

CRK Polyclonal Antibody

Sign In for Pricing
View Details