Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein sigma (SFN)

Recombinant Human 14-3-3 protein sigma (SFN) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 14-3-3 protein sigma (SFN) . Accession Number: P31947; SFN. Expression Region: 1-248aa. Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged. Theoretical MW: 62.9kda. Target Synonyms: Epithelial cell marker protein 1; Stratifin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 14-3-3 protein sigma (SFN) is a purified Recombinant Protein.

Accession Number

P31947; SFN

Expression Region

1-248aa

Host

E. coli

Target

14-3-3 protein sigma (SFN)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-GST-Tagged and C-Terminal Myc-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

62.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Epithelial cell marker protein 1; Stratifin

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CCNB2 (S22) Antibody
E45R05318G-4 50 µL

Phospho-CCNB2 (S22) Antibody

Sign In for Pricing
View Details
Human Matrix MetalloProteinase 9 (MMP-9) ELISA Kit
JL29650-01 48 Tests

Human Matrix MetalloProteinase 9 (MMP-9) ELISA Kit

Sign In for Pricing
View Details
Human Matrix MetalloProteinase 9 (MMP-9) ELISA Kit
JL29650-02 96 Tests

Human Matrix MetalloProteinase 9 (MMP-9) ELISA Kit

Sign In for Pricing
View Details
ALAD (Aminolevulinate Delta Dehydratase, ALADH, PBGS, Delta-Aminolevulinic Acid Dehydratase, Porphobilinogen Synthase)
362076 200 µL

ALAD (Aminolevulinate Delta Dehydratase, ALADH, PBGS, Delta-Aminolevulinic Acid Dehydratase, Porphobilinogen Synthase)

Sign In for Pricing
View Details
[pGlu3]-TLQP-21 (3-21) amide (Human)
007-83 100 µg

[pGlu3]-TLQP-21 (3-21) amide (Human)

Sign In for Pricing
View Details
SGCA sgRNA CRISPR Lentivector set (Human)
K2136001 3x 1.0 µg

SGCA sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details