Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear receptor subfamily 4 group A member 1 (NR4A1)

Recombinant Human Nuclear receptor subfamily 4 group A member 1 (NR4A1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Nuclear receptor subfamily 4 group A member 1 (NR4A1) . Accession Number: P22736; NR4A1. Expression Region: 1-598aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 69.5kda. Target Synonyms: Early response protein NAK1; Nuclear hormone receptor NUR/77; Nur77; Orphan nuclear receptor HMR; Orphan nuclear receptor TR3; ST-59; Testicular receptor 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Nuclear receptor subfamily 4 group A member 1 (NR4A1) is a purified Recombinant Protein.

Accession Number

P22736; NR4A1

Expression Region

1-598aa

Host

E. coli

Target

Nuclear receptor subfamily 4 group A member 1 (NR4A1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

69.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Early response protein NAK1; Nuclear hormone receptor NUR/77; Nur77; Orphan nuclear receptor HMR; Orphan nuclear receptor TR3; ST-59; Testicular receptor 3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 1 alpha (IL-1a) discontinued
I7663-01B-01 50 µg

Interleukin 1 alpha (IL-1a) discontinued

Sign In for Pricing
View Details
Interleukin 1 alpha (IL-1a) discontinued
I7663-01B-02 100 µg

Interleukin 1 alpha (IL-1a) discontinued

Sign In for Pricing
View Details
RPS27P11 3'UTR Lenti-reporter-Luc Vector
42374081 1.0 µg

RPS27P11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DYNLL2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV674852 1.0 µg DNA

DYNLL2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Porcine MUC7 (Mucin 7) ELISA Kit
MBS2503991-01 24 Tests

Porcine MUC7 (Mucin 7) ELISA Kit

Sign In for Pricing
View Details
Porcine MUC7 (Mucin 7) ELISA Kit
MBS2503991-02 48 Tests

Porcine MUC7 (Mucin 7) ELISA Kit

Sign In for Pricing
View Details