Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain OK-0514) (BCoV) (BCV) . Target Name: Non-structural protein of 4.8 kDa (4b) . Accession Number: P0C2R8; 4b. Expression Region: 1-45aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 17.9kda. Target Synonyms: ns4.8; 4.8 kDa accessory protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein.

Accession Number

P0C2R8; 4b

Expression Region

1-45aa

Host

E. coli

Target

Non-structural protein of 4.8 kDa (4b)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ns4.8; 4.8 kDa accessory protein

Species

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Protein Name

Recombinant Protein

AA Sequence

MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (FITC) discontinued
C2255-27C-FITC 100 µL

CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (FITC) discontinued

Sign In for Pricing
View Details
Olfr985 (NM_146855) Mouse Tagged ORF Clone Lentiviral Particle
MR213297L4V 200 µL

Olfr985 (NM_146855) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Acsl4 (NM_207625) Mouse Recombinant Protein
TP510200 20 µg

Acsl4 (NM_207625) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human CUBN sgRNA gene knockout kit - Lentiviral human CUBN sgRNA gene knockout kit (100)
GTR15397000 1 Vial

Lentiviral human CUBN sgRNA gene knockout kit - Lentiviral human CUBN sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Streptococcus Sanguinis fmt Protein (aa 1-311)
VAng-Cr8262-500gEcoli 500 µg (E. coli)

Recombinant Streptococcus Sanguinis fmt Protein (aa 1-311)

Sign In for Pricing
View Details
TAT (Tyrosine Aminotransferase) (FITC)
MBS6179161-01 0.1 mL

TAT (Tyrosine Aminotransferase) (FITC)

Sign In for Pricing
View Details