Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain OK-0514) (BCoV) (BCV) . Target Name: Non-structural protein of 4.8 kDa (4b) . Accession Number: P0C2R8; 4b. Expression Region: 1-45aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 17.9kda. Target Synonyms: ns4.8; 4.8 kDa accessory protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein.

Accession Number

P0C2R8; 4b

Expression Region

1-45aa

Host

E. coli

Target

Non-structural protein of 4.8 kDa (4b)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ns4.8; 4.8 kDa accessory protein

Species

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Protein Name

Recombinant Protein

AA Sequence

MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal MICA Antibody (CLN-619) [Janelia Fluor 635]
NBP3-28737JF635 0.1 mL

Human Monoclonal MICA Antibody (CLN-619) [Janelia Fluor 635]

Sign In for Pricing
View Details
Nucleolin Antibody / NCL
V4961-100UG 100 µg

Nucleolin Antibody / NCL

Sign In for Pricing
View Details
Human Betacellulin MAb (Clone 34301)
MAB2611-SP 25 µg

Human Betacellulin MAb (Clone 34301)

Sign In for Pricing
View Details
MMRN1 (NM_007351) Human Tagged ORF Clone
RG209545 10 µg

MMRN1 (NM_007351) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Peritoneum PrimaCell™: Normal Peritoneal Capillary Endothelial Cells
2-96097 1 Kit

Human Peritoneum PrimaCell™: Normal Peritoneal Capillary Endothelial Cells

Sign In for Pricing
View Details
Human STEAP4 Recombinant Protein
PROTQ687X5-500ug 500 µg

Human STEAP4 Recombinant Protein

Sign In for Pricing
View Details