Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain OK-0514) (BCoV) (BCV) . Target Name: Non-structural protein of 4.8 kDa (4b) . Accession Number: P0C2R8; 4b. Expression Region: 1-45aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 17.9kda. Target Synonyms: ns4.8; 4.8 kDa accessory protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein.

Accession Number

P0C2R8; 4b

Expression Region

1-45aa

Host

E. coli

Target

Non-structural protein of 4.8 kDa (4b)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ns4.8; 4.8 kDa accessory protein

Species

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Protein Name

Recombinant Protein

AA Sequence

MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMZ1 (NM_133463) Human Over-expression Lysate
LY408800 100 µg

AMZ1 (NM_133463) Human Over-expression Lysate

Sign In for Pricing
View Details
XIRP1, CT (XIRP1, CMYA1, XIN, Xin actin-binding repeat-containing protein 1, Cardiomyopathy-associated protein 1) (AP) discontinued
043917-AP 200 µL

XIRP1, CT (XIRP1, CMYA1, XIN, Xin actin-binding repeat-containing protein 1, Cardiomyopathy-associated protein 1) (AP) discontinued

Sign In for Pricing
View Details
C6orf162 sgRNA CRISPR Lentivector (Human) (Target 2)
K0249103 1.0 µg DNA

C6orf162 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Moesin Mouse Monoclonal Antibody
MBS439525-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Moesin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Moesin Mouse Monoclonal Antibody
MBS439525-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Moesin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Moesin Mouse Monoclonal Antibody
MBS439525-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Moesin Mouse Monoclonal Antibody

Sign In for Pricing
View Details