Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain OK-0514) (BCoV) (BCV) . Target Name: Non-structural protein of 4.8 kDa (4b) . Accession Number: P0C2R8; 4b. Expression Region: 1-45aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 17.9kda. Target Synonyms: ns4.8; 4.8 kDa accessory protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein.

Accession Number

P0C2R8; 4b

Expression Region

1-45aa

Host

E. coli

Target

Non-structural protein of 4.8 kDa (4b)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ns4.8; 4.8 kDa accessory protein

Species

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Protein Name

Recombinant Protein

AA Sequence

MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ADAM5, GST-tagged
ADAM5-9380H 25 µg

Recombinant Human ADAM5, GST-tagged

Sign In for Pricing
View Details
5- (((4-Nitrobenzyl) oxy) carbonyl) -3,3a,4,5,6,7-hexahydro-[1,2,3]oxadiazolo[3,4-a]pyrazin-8-ium-3-olate
OR1041087-01 100 mg

5- (((4-Nitrobenzyl) oxy) carbonyl) -3,3a,4,5,6,7-hexahydro-[1,2,3]oxadiazolo[3,4-a]pyrazin-8-ium-3-olate

Sign In for Pricing
View Details
5- (((4-Nitrobenzyl) oxy) carbonyl) -3,3a,4,5,6,7-hexahydro-[1,2,3]oxadiazolo[3,4-a]pyrazin-8-ium-3-olate
OR1041087-02 250 mg

5- (((4-Nitrobenzyl) oxy) carbonyl) -3,3a,4,5,6,7-hexahydro-[1,2,3]oxadiazolo[3,4-a]pyrazin-8-ium-3-olate

Sign In for Pricing
View Details
5- (((4-Nitrobenzyl) oxy) carbonyl) -3,3a,4,5,6,7-hexahydro-[1,2,3]oxadiazolo[3,4-a]pyrazin-8-ium-3-olate
OR1041087-03 1 g

5- (((4-Nitrobenzyl) oxy) carbonyl) -3,3a,4,5,6,7-hexahydro-[1,2,3]oxadiazolo[3,4-a]pyrazin-8-ium-3-olate

Sign In for Pricing
View Details
EIF2AK3 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 3, DKFZp781H1925, HRI, PEK, PERK, WRS) (MaxLight 490)
245639-ML490 100 µL

EIF2AK3 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 3, DKFZp781H1925, HRI, PEK, PERK, WRS) (MaxLight 490)

Sign In for Pricing
View Details
Archaemetzincin 2 (AMZ2) (NM_001033570) Human Untagged Clone
SC302738 10 µg

Archaemetzincin 2 (AMZ2) (NM_001033570) Human Untagged Clone

Sign In for Pricing
View Details