Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain OK-0514) (BCoV) (BCV) . Target Name: Non-structural protein of 4.8 kDa (4b) . Accession Number: P0C2R8; 4b. Expression Region: 1-45aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 17.9kda. Target Synonyms: ns4.8; 4.8 kDa accessory protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein.

Accession Number

P0C2R8; 4b

Expression Region

1-45aa

Host

E. coli

Target

Non-structural protein of 4.8 kDa (4b)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ns4.8; 4.8 kDa accessory protein

Species

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Protein Name

Recombinant Protein

AA Sequence

MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Monkeypox Virus Monoclonal antibody, clone 6D8
CABT-CS622 200 ug

Rabbit Anti-Monkeypox Virus Monoclonal antibody, clone 6D8

Sign In for Pricing
View Details
Lentiviral human SPATA20 shRNA (UAS) - Lentiviral human SPATA20 shRNA (UAS) (25)
GTR15092093 1 Vial

Lentiviral human SPATA20 shRNA (UAS) - Lentiviral human SPATA20 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Monoclonal TRAILR2/TNFRSF10B Antibody (HS201) [DyLight 594]
NBP2-80067DL594 0.1 mL

Mouse Monoclonal TRAILR2/TNFRSF10B Antibody (HS201) [DyLight 594]

Sign In for Pricing
View Details
Human ELA1 (Elastase 1, Pancreatic) ELISA Kit
E-EL-H5601-01 24 Tests

Human ELA1 (Elastase 1, Pancreatic) ELISA Kit

Sign In for Pricing
View Details
Human ELA1 (Elastase 1, Pancreatic) ELISA Kit
E-EL-H5601-02 48 Tests

Human ELA1 (Elastase 1, Pancreatic) ELISA Kit

Sign In for Pricing
View Details
Human ELA1 (Elastase 1, Pancreatic) ELISA Kit
E-EL-H5601-03 96 Tests

Human ELA1 (Elastase 1, Pancreatic) ELISA Kit

Sign In for Pricing
View Details