Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain OK-0514) (BCoV) (BCV) . Target Name: Non-structural protein of 4.8 kDa (4b) . Accession Number: P0C2R8; 4b. Expression Region: 1-45aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 17.9kda. Target Synonyms: ns4.8; 4.8 kDa accessory protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein.

Accession Number

P0C2R8; 4b

Expression Region

1-45aa

Host

E. coli

Target

Non-structural protein of 4.8 kDa (4b)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ns4.8; 4.8 kDa accessory protein

Species

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Protein Name

Recombinant Protein

AA Sequence

MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1308612 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV634173 1.0 µg DNA

RGD1308612 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Pdzrn3 (BC010329) Mouse Tagged Lenti ORF Clone
MR209785L3 10 µg

Pdzrn3 (BC010329) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Clathrin heavy chain (Chc), partial
MBS1154394-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster Clathrin heavy chain (Chc), partial

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Clathrin heavy chain (Chc), partial
MBS1154394-02 0.1 mg (E-Coli)

Recombinant Drosophila melanogaster Clathrin heavy chain (Chc), partial

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Clathrin heavy chain (Chc), partial
MBS1154394-03 1 mg (E-Coli)

Recombinant Drosophila melanogaster Clathrin heavy chain (Chc), partial

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Clathrin heavy chain (Chc), partial
MBS1154394-04 5x 1 mg (E-Coli)

Recombinant Drosophila melanogaster Clathrin heavy chain (Chc), partial

Sign In for Pricing
View Details