Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain OK-0514) (BCoV) (BCV) . Target Name: Non-structural protein of 4.8 kDa (4b) . Accession Number: P0C2R8; 4b. Expression Region: 1-45aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 17.9kda. Target Synonyms: ns4.8; 4.8 kDa accessory protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) is a purified Recombinant Protein.

Accession Number

P0C2R8; 4b

Expression Region

1-45aa

Host

E. coli

Target

Non-structural protein of 4.8 kDa (4b)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ns4.8; 4.8 kDa accessory protein

Species

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Protein Name

Recombinant Protein

AA Sequence

MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HYLS1 sgRNA gene knockout kit - Lentiviral human HYLS1 sgRNA gene knockout kit (plasmid)
GTR15393866 1 Vial

Lentiviral human HYLS1 sgRNA gene knockout kit - Lentiviral human HYLS1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Lentiviral mouse Rgl1 shRNA (UAS) - Lentiviral mouse Rgl1 shRNA (UAS, RFP) (100)
GTR15189828 1 Vial

Lentiviral mouse Rgl1 shRNA (UAS) - Lentiviral mouse Rgl1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rnf149 (NM_001033135) Mouse Tagged Lenti ORF Clone
MR218021L3 10 µg

Rnf149 (NM_001033135) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Famitinib (malate)
HY-108713A 1 Each

Famitinib (malate)

Sign In for Pricing
View Details
AGXT (NM_000030) Human Tagged Lenti ORF Clone
RC212899L3 10 µg

AGXT (NM_000030) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Hsa-miR-3189-5p miRNA Inhibitor
CIH1394-01 10 nmol

Hsa-miR-3189-5p miRNA Inhibitor

Sign In for Pricing
View Details