Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabies virus Matrix protein (M)

Recombinant Rabies virus Matrix protein (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabies virus (strain PM1503/AVO1) (RABV) . Target Name: Matrix protein (M) . Accession Number: P15200; M. Expression Region: 1-202aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 49.9kda. Target Synonyms: Phosphoprotein M2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rabies virus Matrix protein (M) is a purified Recombinant Protein.

Accession Number

P15200; M

Expression Region

1-202aa

Host

E. coli

Target

Matrix protein (M)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

49.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Phosphoprotein M2

Species

Rabies virus (strain PM1503/AVO1) (RABV)

Protein Name

Recombinant Protein

AA Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C20orf96 activation kit by CRISPRa
GA115383 1 Kit

Human C20orf96 activation kit by CRISPRa

Sign In for Pricing
View Details
ARL17B Human Gene Knockout Kit (CRISPR)
KN418342 1 Kit

ARL17B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF568 conjugate, 0.1mg/mL
BNC681648-100 1x 100 µL

TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6B (KRT6B) Rabbit Polyclonal Antibody
TA362052 100 µL

Cytokeratin 6B (KRT6B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 594-11-dUTP
E-CK-A122D-01 25 µL

Elab Fluor® 594-11-dUTP

Sign In for Pricing
View Details
Elab Fluor® 594-11-dUTP
E-CK-A122D-02 250 µL

Elab Fluor® 594-11-dUTP

Sign In for Pricing
View Details