Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabies virus Matrix protein (M)

Recombinant Rabies virus Matrix protein (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabies virus (strain PM1503/AVO1) (RABV) . Target Name: Matrix protein (M) . Accession Number: P15200; M. Expression Region: 1-202aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 49.9kda. Target Synonyms: Phosphoprotein M2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rabies virus Matrix protein (M) is a purified Recombinant Protein.

Accession Number

P15200; M

Expression Region

1-202aa

Host

E. coli

Target

Matrix protein (M)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

49.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Phosphoprotein M2

Species

Rabies virus (strain PM1503/AVO1) (RABV)

Protein Name

Recombinant Protein

AA Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H4]
TA503395AM 100 µL

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H4]

Sign In for Pricing
View Details
ELOVL1 Rabbit Polyclonal Antibody
AP01399PU-N 100 µg

ELOVL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTOR Mouse Monoclonal Antibody [Clone ID: OTI3E5]
CF805913 100 µg

MTOR Mouse Monoclonal Antibody [Clone ID: OTI3E5]

Sign In for Pricing
View Details
SMAD1 Rabbit Monoclonal Antibody [Clone ID: R07-4A3]
TA421967 100 µL

SMAD1 Rabbit Monoclonal Antibody [Clone ID: R07-4A3]

Sign In for Pricing
View Details
Recombinant Human DR6/TNFRSF21 Protein (His Tag)
PKSH031800-01 100 µg

Recombinant Human DR6/TNFRSF21 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DR6/TNFRSF21 Protein (His Tag)
PKSH031800-02 1 mg

Recombinant Human DR6/TNFRSF21 Protein (His Tag)

Sign In for Pricing
View Details