Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD)

Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Formimidoyltransferase-cyclodeaminase (FTCD) . Accession Number: O95954; FTCD. Expression Region: 1-541aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 65.0kda. Target Synonyms: Formiminotransferase-cyclodeaminase; FTCD; LCHC1; Glutamate formimidoyltransferase; Glutamate formiminotransferase; Glutamate formyltransferase; Formimidoyltetrahydrofolate cyclodeaminase; Formiminotetrahydrofolate cyclodeaminase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD) is a purified Recombinant Protein.

Accession Number

O95954; FTCD

Expression Region

1-541aa

Host

E. coli

Target

Formimidoyltransferase-cyclodeaminase (FTCD)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

65.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Formiminotransferase-cyclodeaminase; FTCD; LCHC1; Glutamate formimidoyltransferase; Glutamate formiminotransferase; Glutamate formyltransferase; Formimidoyltetrahydrofolate cyclodeaminase; Formiminotetrahydrofolate cyclodeaminase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CXADR Antibody (020) [PerCP]
NBP2-89642PCP 0.1 mL

Rabbit Monoclonal CXADR Antibody (020) [PerCP]

Sign In for Pricing
View Details
OPN1MW2 Double Nickase Plasmid (h2)
sc-418725-NIC-2 20 µg

OPN1MW2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Glypican-3 Antibody / GPC3
V5351-100UG 100 µg

Glypican-3 Antibody / GPC3

Sign In for Pricing
View Details
Utp14b AAV Vector (Mouse) (CMV)
49390104 1 µg

Utp14b AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Synaptophysin (SYP)
MBS2115522-01 0.1 mL

HRP-Linked Polyclonal Antibody to Synaptophysin (SYP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Synaptophysin (SYP)
MBS2115522-02 0.2 mL

HRP-Linked Polyclonal Antibody to Synaptophysin (SYP)

Sign In for Pricing
View Details