Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis Pesticidal crystal protein cry1Bb (cry1Bb), partial

Recombinant Bacillus thuringiensis Pesticidal crystal protein cry1Bb (cry1Bb), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis. Target Name: Pesticidal crystal protein cry1Bb (cry1Bb) . Accession Number: Q45739; cry1Bb. Expression Region: 1111-1229aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 21.1kda. Target Synonyms: 140 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIB (b) Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bacillus thuringiensis Pesticidal crystal protein cry1Bb (cry1Bb), partial is a purified Recombinant Protein.

Accession Number

Q45739; cry1Bb

Expression Region

1111-1229aa

Host

E. coli

Target

Pesticidal crystal protein cry1Bb (cry1Bb)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

140 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIB (b)

Species

Bacillus thuringiensis

Protein Name

Recombinant Protein

AA Sequence

NCEEEEVYPTDTGTCNDYTAHQGTAACNSRNAGYEDAYEVDTTASVNYKPTYEEETYTDVRRDNHCEYDRGYVNYPPVPAGYVTKELEYFPETDTVWIEIGETEGKFIVDSVELLLMEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT8P35 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV730544 1.0 µg DNA

KRT8P35 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 7 (FGF7) CLIA Kit
abx491803-01 96 Tests

Mouse Fibroblast Growth Factor 7 (FGF7) CLIA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 7 (FGF7) CLIA Kit
abx491803-02 5x 96 Tests

Mouse Fibroblast Growth Factor 7 (FGF7) CLIA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 7 (FGF7) CLIA Kit
abx491803-03 10x 96 Tests

Mouse Fibroblast Growth Factor 7 (FGF7) CLIA Kit

Sign In for Pricing
View Details
TNFRSF25 Protein (C-Fc, Human)
P509134 100 µg

TNFRSF25 Protein (C-Fc, Human)

Sign In for Pricing
View Details
RhoGAP (ARHGAP5) Human siRNA Oligo Duplex (Locus ID 394)
SR300285 1 Kit

RhoGAP (ARHGAP5) Human siRNA Oligo Duplex (Locus ID 394)

Sign In for Pricing
View Details