Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mannan-binding protein (Mbl2)

Recombinant Mouse Mannan-binding protein (Mbl2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Mannan-binding protein (Mbl2) . Accession Number: Q3UEK1; Mbl2. Expression Region: 19-244aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 29.9kda. Target Synonyms: Mannose-binding protein C Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Mannan-binding protein (Mbl2) is a purified Recombinant Protein.

Accession Number

Q3UEK1; Mbl2

Expression Region

19-244aa

Host

E. coli

Target

Mannan-binding protein (Mbl2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mannose-binding protein C

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal VSTM4 Antibody (2694A) [Janelia Fluor 635]
FAB10767JF635 0.1 mL

Rabbit Monoclonal VSTM4 Antibody (2694A) [Janelia Fluor 635]

Sign In for Pricing
View Details
CD7 (C7/511), CF740 conjugate, 0.1mg/mL
BNC740511-100 1x 100 µL

CD7 (C7/511), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PKA C alpha + beta Rabbit pAb, PerCP-Cy7 conjugated
orb2819505 100 µL

PKA C alpha + beta Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Lentiviral human GJB4 sgRNA gene knockout kit - Lentiviral human GJB4 sgRNA gene knockout kit (100)
GTR15364756 1 Vial

Lentiviral human GJB4 sgRNA gene knockout kit - Lentiviral human GJB4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human Subcutaneous Adipocyte Culture Medium
ARM1001 500 mL

Human Subcutaneous Adipocyte Culture Medium

Sign In for Pricing
View Details
Mouse Obox3 activation kit by CRISPRa
GA215361 1 Kit

Mouse Obox3 activation kit by CRISPRa

Sign In for Pricing
View Details