Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poliovirus receptor (PVR; I340M), partial , Active Protein

Recombinant Human Poliovirus receptor (PVR; I340M), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Poliovirus receptor (PVR; I340M) . Accession Number: P15151; PVR. Expression Region: 21-343aa (I340M) . Tag Info: C-terminal hFc-tagged. Theoretical MW: 64.0kda. Target Synonyms: Nectin-like protein 5; NECL-5; CD antigen CD155 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Poliovirus receptor (PVR; I340M), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P15151; PVR

Expression Region

21-343aa (I340M)

Host

Mammalian Cells

Target

Poliovirus receptor (PVR; I340M)

Conjugation

Unconjugated

Tag

C-Terminal hFc-Tagged

Field of Research

Microbiology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nectin-like protein 5; NECL-5; CD antigen CD155

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (3,4,5-Trifluorophenyl) ethan-1-amine hydrochloride
HHC67940-01 50 mg

2- (3,4,5-Trifluorophenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
2- (3,4,5-Trifluorophenyl) ethan-1-amine hydrochloride
HHC67940-02 0.5 g

2- (3,4,5-Trifluorophenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
LAG3 Antibody [9F9]
MBS154611-01 0.1 mg

LAG3 Antibody [9F9]

Sign In for Pricing
View Details
LAG3 Antibody [9F9]
MBS154611-02 5x 0.1 mg

LAG3 Antibody [9F9]

Sign In for Pricing
View Details
GABPB2 Protein Vector (Mouse) (pPM-C-HA)
21151025 500 ng

GABPB2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Ms4a15 sgRNA CRISPR Lentivector set (Rat)
K6209201 3x 1.0 µg

Ms4a15 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details