Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poliovirus receptor (PVR; I340M), partial , Active Protein

Recombinant Human Poliovirus receptor (PVR; I340M), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Poliovirus receptor (PVR; I340M) . Accession Number: P15151; PVR. Expression Region: 21-343aa (I340M) . Tag Info: C-terminal hFc-tagged. Theoretical MW: 64.0kda. Target Synonyms: Nectin-like protein 5; NECL-5; CD antigen CD155 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Poliovirus receptor (PVR; I340M), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P15151; PVR

Expression Region

21-343aa (I340M)

Host

Mammalian Cells

Target

Poliovirus receptor (PVR; I340M)

Conjugation

Unconjugated

Tag

C-Terminal hFc-Tagged

Field of Research

Microbiology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nectin-like protein 5; NECL-5; CD antigen CD155

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1/CTRP1) ELISA Kit
SL1715Ra-01 48 Tests

Rat Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1/CTRP1) ELISA Kit

Sign In for Pricing
View Details
Rat Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1/CTRP1) ELISA Kit
SL1715Ra-02 96 Tests

Rat Complement C1q tumor necrosis factor-related protein 1 (C1QTNF1/CTRP1) ELISA Kit

Sign In for Pricing
View Details
RETN Antibody
CSB-PA07079A0Rb-01 50 µg

RETN Antibody

Sign In for Pricing
View Details
RETN Antibody
CSB-PA07079A0Rb-02 100 µg

RETN Antibody

Sign In for Pricing
View Details
IRF2BP2 CRISPR Knock Out 293T Cell Line (Human)
25080141 1x 10^6 Cells / 1.0 mL

IRF2BP2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
rno-miR-193a-5p miRNA Inhibitor
MBS8297565-01 10 nmol

rno-miR-193a-5p miRNA Inhibitor

Sign In for Pricing
View Details