Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S; V367F), partial , Active Protein

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S; V367F), partial , Active Protein is a purified Active Recombinant Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) . Target Name: Spike glycoprotein (S; V367F) . Accession Number: P0DTC2; S. Expression Region: 319-541aa (V367F) . Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 27.9kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S; V367F), partial , Active Protein is a purified Active Recombinant Coronavirus Protein.

Accession Number

P0DTC2; S

Expression Region

319-541aa (V367F)

Host

Mammalian Cells

Target

Spike glycoprotein (S; V367F)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Microbiology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>90% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Protein Name

Active Recombinant Coronavirus Protein

AA Sequence

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSFLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGR/PR (PGR, NR3C3, Progesterone receptor, Nuclear receptor subfamily 3 group C member 3)
MBS6008779-01 0.2 mL

PGR/PR (PGR, NR3C3, Progesterone receptor, Nuclear receptor subfamily 3 group C member 3)

Sign In for Pricing
View Details
PGR/PR (PGR, NR3C3, Progesterone receptor, Nuclear receptor subfamily 3 group C member 3)
MBS6008779-02 5x 0.2 mL

PGR/PR (PGR, NR3C3, Progesterone receptor, Nuclear receptor subfamily 3 group C member 3)

Sign In for Pricing
View Details
Anti-INI-1 antibody
STJ180136 0.1 ml

Anti-INI-1 antibody

Sign In for Pricing
View Details
ERBB4 Conjugated Antibody
MBS9452071-01 0.1 mL (Biotin)

ERBB4 Conjugated Antibody

Sign In for Pricing
View Details
ERBB4 Conjugated Antibody
MBS9452071-02 0.1 mL (AF350)

ERBB4 Conjugated Antibody

Sign In for Pricing
View Details
ERBB4 Conjugated Antibody
MBS9452071-03 0.1 mL (AF405)

ERBB4 Conjugated Antibody

Sign In for Pricing
View Details