Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine receptor common subunit gamma (IL2RG; N75Q), partial

Recombinant Human Cytokine receptor common subunit gamma (IL2RG; N75Q), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Cytokine receptor common subunit gamma (IL2RG; N75Q) . Accession Number: P31785; IL2RG. Expression Region: 56-254aa (N75Q) . Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 25.0kda. Target Synonyms: Cytokine receptor common subunit gamma; Interleukin-2 receptor subunit gamma; IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG; gammaC; p64; CD antigen CD132 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Cytokine receptor common subunit gamma (IL2RG; N75Q), partial is a purified Recombinant Protein.

Accession Number

P31785; IL2RG

Expression Region

56-254aa (N75Q)

Host

Baculovirus

Target

Cytokine receptor common subunit gamma (IL2RG; N75Q)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytokine receptor common subunit gamma; Interleukin-2 receptor subunit gamma; IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG; gammaC; p64; CD antigen CD132

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR183 Human shRNA Lentiviral Particle (Locus ID 1880)
TL313315V 500 µL Each

GPR183 Human shRNA Lentiviral Particle (Locus ID 1880)

Sign In for Pricing
View Details
Intersectin shRNA (m) Lentiviral Particles
sc-41366-V 200 µL

Intersectin shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
DSC2 Protein Vector (Rat) (pPM-C-HA)
PV264916 500 ng

DSC2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RPL19P15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
40958111 3x 1.0 µg

RPL19P15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
DEGS1, NT (DEGS1, DES1, MLD, Sphingolipid delta(4)-desaturase DES1, Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, Membrane lipid desaturase) (MaxLight 550)
MBS6291647-01 0.1 mL

DEGS1, NT (DEGS1, DES1, MLD, Sphingolipid delta(4)-desaturase DES1, Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, Membrane lipid desaturase) (MaxLight 550)

Sign In for Pricing
View Details
DEGS1, NT (DEGS1, DES1, MLD, Sphingolipid delta(4)-desaturase DES1, Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, Membrane lipid desaturase) (MaxLight 550)
MBS6291647-02 5x 0.1 mL

DEGS1, NT (DEGS1, DES1, MLD, Sphingolipid delta(4)-desaturase DES1, Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, Membrane lipid desaturase) (MaxLight 550)

Sign In for Pricing
View Details