Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial

Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor ligand superfamily member 11 (TNFSF11) . Accession Number: O14788; TNFSF11. Expression Region: 63-244aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 22.7kda. Target Synonyms: Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD254 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial is a purified Recombinant Protein.

Accession Number

O14788; TNFSF11

Expression Region

63-244aa

Host

Mammalian Cells

Target

Tumor necrosis factor ligand superfamily member 11 (TNFSF11)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Biologically Active

Length

Partial of Isoform2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD254

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-500 1x 500 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (E67), CF405S conjugate, 0.1mg/mL
BNC040673-500 1x 500 µL

Cyclin A2 (E67), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details