Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon regulatory factor 1 (IRF1; K29R)

Recombinant Human Interferon regulatory factor 1 (IRF1; K29R) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Interferon regulatory factor 1 (IRF1; K29R) . Accession Number: P10914; IRF1. Expression Region: 1-325aa (K29R) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 41.5kda. Target Synonyms: IRF-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interferon regulatory factor 1 (IRF1; K29R) is a purified Recombinant Protein.

Accession Number

P10914; IRF1

Expression Region

1-325aa (K29R)

Host

E. coli

Target

Interferon regulatory factor 1 (IRF1; K29R)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IRF-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINREEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBBP4P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV742441 1.0 µg DNA

RBBP4P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
PDE7B (cAMP-specific 3',5'-cyclic Phosphodiesterase 7B) APC
MBS6388801-01 0.1 mL

PDE7B (cAMP-specific 3',5'-cyclic Phosphodiesterase 7B) APC

Sign In for Pricing
View Details
PDE7B (cAMP-specific 3',5'-cyclic Phosphodiesterase 7B) APC
MBS6388801-02 5x 0.1 mL

PDE7B (cAMP-specific 3',5'-cyclic Phosphodiesterase 7B) APC

Sign In for Pricing
View Details
Rabbit Monoclonal p16INK4a/CDKN2A Antibody (CDKN2A/7660R) [Allophycocyanin]
NBP3-20900APC 0.1 mL

Rabbit Monoclonal p16INK4a/CDKN2A Antibody (CDKN2A/7660R) [Allophycocyanin]

Sign In for Pricing
View Details
3-Methyl-1- (pyridin-3-ylmethyl) piperazine dihydrochloride
DXC57165-01 50 mg

3-Methyl-1- (pyridin-3-ylmethyl) piperazine dihydrochloride

Sign In for Pricing
View Details
3-Methyl-1- (pyridin-3-ylmethyl) piperazine dihydrochloride
DXC57165-02 0.5 g

3-Methyl-1- (pyridin-3-ylmethyl) piperazine dihydrochloride

Sign In for Pricing
View Details