Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon regulatory factor 1 (IRF1; K29R)

Recombinant Human Interferon regulatory factor 1 (IRF1; K29R) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Interferon regulatory factor 1 (IRF1; K29R) . Accession Number: P10914; IRF1. Expression Region: 1-325aa (K29R) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 41.5kda. Target Synonyms: IRF-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interferon regulatory factor 1 (IRF1; K29R) is a purified Recombinant Protein.

Accession Number

P10914; IRF1

Expression Region

1-325aa (K29R)

Host

E. coli

Target

Interferon regulatory factor 1 (IRF1; K29R)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IRF-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINREEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST6GALNAC2 Rabbit Polyclonal Antibody (Fluoro647)
orb3096417 100 µg

ST6GALNAC2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Sheep Polyclonal anti-Human IGFBP-3
hAP-5953 50 µg

Sheep Polyclonal anti-Human IGFBP-3

Sign In for Pricing
View Details
Mroh2a (NM_001281466) Mouse Tagged ORF Clone
MR231858 10 µg

Mroh2a (NM_001281466) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human PAK6 Protein - (Dry Ice)
H00056924-P01-2ug 2 µg

Recombinant Human PAK6 Protein - (Dry Ice)

Sign In for Pricing
View Details
FUT6 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-13230R-BF488 100 µL

FUT6 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Pig Coagulation Factor Viii, Fviii Elisa Kit
EKC38136 96 Tests

Pig Coagulation Factor Viii, Fviii Elisa Kit

Sign In for Pricing
View Details