Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein DEK (DEK; S375SLEH), partial

Recombinant Human Protein DEK (DEK; S375SLEH), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Protein DEK (DEK; S375SLEH) . Accession Number: P35659; DEK. Expression Region: 309-375aa (S375SLEH) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 15.7kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Protein DEK (DEK; S375SLEH), partial is a purified Recombinant Protein.

Accession Number

P35659; DEK

Expression Region

309-375aa (S375SLEH)

Host

E. coli

Target

Protein DEK (DEK; S375SLEH)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLG1 Knockout NCI-H1299 Polyclonal Cells
ARG38884 1 Million

DLG1 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Mouse Monoclonal MUC5AC Antibody (CLH2) [DyLight 488]
NBP3-11458G 0.1 mL

Mouse Monoclonal MUC5AC Antibody (CLH2) [DyLight 488]

Sign In for Pricing
View Details
SCML1 (Sex Comb on Midleg-like Protein 1) (Biotin)
133020-Biotin 100 µL

SCML1 (Sex Comb on Midleg-like Protein 1) (Biotin)

Sign In for Pricing
View Details
Serotonin receptor 3C Blocking Peptide
33R-1655 100 ug

Serotonin receptor 3C Blocking Peptide

Sign In for Pricing
View Details
VSTM2B (NM_001146339) Human Tagged Lenti ORF Clone
RC228218L3 10 µg

VSTM2B (NM_001146339) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gm766 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3302205 3x 1.0 µg

Gm766 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details