Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein DEK (DEK; S375SLEH), partial

Recombinant Human Protein DEK (DEK; S375SLEH), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Protein DEK (DEK; S375SLEH) . Accession Number: P35659; DEK. Expression Region: 309-375aa (S375SLEH) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 15.7kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Protein DEK (DEK; S375SLEH), partial is a purified Recombinant Protein.

Accession Number

P35659; DEK

Expression Region

309-375aa (S375SLEH)

Host

E. coli

Target

Protein DEK (DEK; S375SLEH)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)
MBS2002526-01 0.1 mL

Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)
MBS2002526-02 0.2 mL

Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)
MBS2002526-03 0.5 mL

Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)
MBS2002526-04 1 mL

Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)
MBS2002526-05 5 mL

Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)
MBS2002526-06 5x 5 mL

Polyclonal Antibody to Secreted Ly6/uPAR Related Protein 1 (SLURP1)

Sign In for Pricing
View Details