Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein DEK (DEK; S375SLEH), partial

Recombinant Human Protein DEK (DEK; S375SLEH), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Protein DEK (DEK; S375SLEH) . Accession Number: P35659; DEK. Expression Region: 309-375aa (S375SLEH) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 15.7kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Protein DEK (DEK; S375SLEH), partial is a purified Recombinant Protein.

Accession Number

P35659; DEK

Expression Region

309-375aa (S375SLEH)

Host

E. coli

Target

Protein DEK (DEK; S375SLEH)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrillarin (FBL) Rabbit Polyclonal Antibody
TA345779 100 µL

Fibrillarin (FBL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tris-Glycine Instant Powder Granules
T7207M 10x 1 L

Tris-Glycine Instant Powder Granules

Sign In for Pricing
View Details
Fluo-3FF (potassium salt)
MBS5798248 Inquire

Fluo-3FF (potassium salt)

Sign In for Pricing
View Details
RGD1311433 3'UTR Luciferase Stable Cell Line
TU217956 1.0 mL

RGD1311433 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ABCD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E9]
TA803560AM 100 µL

ABCD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E9]

Sign In for Pricing
View Details
Ddr1 3'UTR Luciferase Stable Cell Line
TU203240 1.0 mL

Ddr1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details