Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F)

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Alpha-2-macroglobulin receptor-associated protein (Lrpap1; H294F, H296F, Y297C, H305F) . Accession Number: P55302; Lrpap1. Expression Region: 248-360aa (H294F, H296F, Y297C, H305F) . Tag Info: N-terminal GFP-tagged and C-terminal 6xHis-tagged. Theoretical MW: 42kda. Target Synonyms: Heparin-binding protein 44; HBP-44; Low density lipoprotein receptor-related protein-associated protein 1; RAP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F) is a purified Recombinant Protein.

Accession Number

P55302; Lrpap1

Expression Region

248-360aa (H294F, H296F, Y297C, H305F)

Host

Baculovirus

Target

Alpha-2-macroglobulin receptor-associated protein (Lrpap1; H294F, H296F, Y297C, H305F)

Conjugation

Unconjugated

Tag

N-Terminal GFP-Tagged and C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Heparin-binding protein 44; HBP-44; Low density lipoprotein receptor-related protein-associated protein 1; RAP

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PMP22 Protein, His (Fc)-Avi-tagged
PMP22-6876M 50 µg

Recombinant Mouse PMP22 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Sult2a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
45852114 3x 1.0 µg

Sult2a1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RNF125 Blocking Peptide
CBP4205-01 1 mg

RNF125 Blocking Peptide

Sign In for Pricing
View Details
RNF125 Blocking Peptide
CBP4205-02 5 mg

RNF125 Blocking Peptide

Sign In for Pricing
View Details
HER2 (I767M), Active
MBS516934-01 0.005 mg

HER2 (I767M), Active

Sign In for Pricing
View Details
HER2 (I767M), Active
MBS516934-02 0.01 mg

HER2 (I767M), Active

Sign In for Pricing
View Details