Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F)

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Alpha-2-macroglobulin receptor-associated protein (Lrpap1; H294F, H296F, Y297C, H305F) . Accession Number: P55302; Lrpap1. Expression Region: 248-360aa (H294F, H296F, Y297C, H305F) . Tag Info: N-terminal GFP-tagged and C-terminal 6xHis-tagged. Theoretical MW: 42kda. Target Synonyms: Heparin-binding protein 44; HBP-44; Low density lipoprotein receptor-related protein-associated protein 1; RAP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F) is a purified Recombinant Protein.

Accession Number

P55302; Lrpap1

Expression Region

248-360aa (H294F, H296F, Y297C, H305F)

Host

Baculovirus

Target

Alpha-2-macroglobulin receptor-associated protein (Lrpap1; H294F, H296F, Y297C, H305F)

Conjugation

Unconjugated

Tag

N-Terminal GFP-Tagged and C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Heparin-binding protein 44; HBP-44; Low density lipoprotein receptor-related protein-associated protein 1; RAP

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZWILCH (Zwilch, kinetochore Associated, Homolog (Drosophila), FLJ10036, FLJ16343, KNTC1AP, MGC111034, hZwilch) (AP)
MBS6163845-01 0.1 mL

ZWILCH (Zwilch, kinetochore Associated, Homolog (Drosophila), FLJ10036, FLJ16343, KNTC1AP, MGC111034, hZwilch) (AP)

Sign In for Pricing
View Details
ZWILCH (Zwilch, kinetochore Associated, Homolog (Drosophila), FLJ10036, FLJ16343, KNTC1AP, MGC111034, hZwilch) (AP)
MBS6163845-02 5x 0.1 mL

ZWILCH (Zwilch, kinetochore Associated, Homolog (Drosophila), FLJ10036, FLJ16343, KNTC1AP, MGC111034, hZwilch) (AP)

Sign In for Pricing
View Details
PRPSAP2 (Phosphoribosyl Pyrophosphate Synthase-Associated Protein 2, Phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2)
489463 100 µL

PRPSAP2 (Phosphoribosyl Pyrophosphate Synthase-Associated Protein 2, Phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2)

Sign In for Pricing
View Details
PNKD Antibody
A31500-100UL 100 µL

PNKD Antibody

Sign In for Pricing
View Details
EIF4G2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV704721 1.0 µg DNA

EIF4G2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CCBP2 discontinued
507729 100 µg

CCBP2 discontinued

Sign In for Pricing
View Details