Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F)

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Alpha-2-macroglobulin receptor-associated protein (Lrpap1; H294F, H296F, Y297C, H305F) . Accession Number: P55302; Lrpap1. Expression Region: 248-360aa (H294F, H296F, Y297C, H305F) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 18.2kda. Target Synonyms: Heparin-binding protein 44; HBP-44; Low density lipoprotein receptor-related protein-associated protein 1; RAP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F) is a purified Recombinant Protein.

Accession Number

P55302; Lrpap1

Expression Region

248-360aa (H294F, H296F, Y297C, H305F)

Host

Baculovirus

Target

Alpha-2-macroglobulin receptor-associated protein (Lrpap1; H294F, H296F, Y297C, H305F)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Heparin-binding protein 44; HBP-44; Low density lipoprotein receptor-related protein-associated protein 1; RAP

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-neuroblastoma-Anti-body (NB-Ab) ELISA Kit
NSL0801r 96 Tests

Rat Anti-neuroblastoma-Anti-body (NB-Ab) ELISA Kit

Sign In for Pricing
View Details
NR1I3 (CAR, Nuclear Receptor Subfamily 1 Group I Member 3, Constitutive Activator of Retinoid Response, Constitutive Androstane Receptor, Orphan Nuclear Receptor MB67) (MaxLight 650)
MBS6401491-01 0.1 mL

NR1I3 (CAR, Nuclear Receptor Subfamily 1 Group I Member 3, Constitutive Activator of Retinoid Response, Constitutive Androstane Receptor, Orphan Nuclear Receptor MB67) (MaxLight 650)

Sign In for Pricing
View Details
NR1I3 (CAR, Nuclear Receptor Subfamily 1 Group I Member 3, Constitutive Activator of Retinoid Response, Constitutive Androstane Receptor, Orphan Nuclear Receptor MB67) (MaxLight 650)
MBS6401491-02 5x 0.1 mL

NR1I3 (CAR, Nuclear Receptor Subfamily 1 Group I Member 3, Constitutive Activator of Retinoid Response, Constitutive Androstane Receptor, Orphan Nuclear Receptor MB67) (MaxLight 650)

Sign In for Pricing
View Details
ACRP30headless (mouse), (recombinant)
MBS566103-01 0.01 mg

ACRP30headless (mouse), (recombinant)

Sign In for Pricing
View Details
ACRP30headless (mouse), (recombinant)
MBS566103-02 5x 0.01 mg

ACRP30headless (mouse), (recombinant)

Sign In for Pricing
View Details
Low-density lipoprotein Receptor-Related protein 5 (LRP5) Mouse ELISA Kit
E7395 96 Tests

Low-density lipoprotein Receptor-Related protein 5 (LRP5) Mouse ELISA Kit

Sign In for Pricing
View Details