Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carboxypeptidase D (CPD), partial

Recombinant Human Carboxypeptidase D (CPD), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Carboxypeptidase D (CPD) . Accession Number: O75976; CPD. Expression Region: 383-461aa. Tag Info: C-terminal hFc-Myc-tagged. Theoretical MW: 37.3kda. Target Synonyms: Metallocarboxypeptidase D gp180 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Carboxypeptidase D (CPD), partial is a purified Recombinant Protein.

Accession Number

O75976; CPD

Expression Region

383-461aa

Host

Mammalian Cells

Target

Carboxypeptidase D (CPD)

Conjugation

Unconjugated

Tag

C-Terminal hFc-Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Metallocarboxypeptidase D gp180

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKK1 (Dickkopf-related Protein 1, Dickkopf-1, Dkk-1, hDkk-1, SK, UNQ492/PRO1008) (MaxLight 405)
MBS6189807-01 0.1 mL

DKK1 (Dickkopf-related Protein 1, Dickkopf-1, Dkk-1, hDkk-1, SK, UNQ492/PRO1008) (MaxLight 405)

Sign In for Pricing
View Details
DKK1 (Dickkopf-related Protein 1, Dickkopf-1, Dkk-1, hDkk-1, SK, UNQ492/PRO1008) (MaxLight 405)
MBS6189807-02 5x 0.1 mL

DKK1 (Dickkopf-related Protein 1, Dickkopf-1, Dkk-1, hDkk-1, SK, UNQ492/PRO1008) (MaxLight 405)

Sign In for Pricing
View Details
KIF3A Rabbit mAb
AB100695 100 µL

KIF3A Rabbit mAb

Sign In for Pricing
View Details
Cytochrome P450 4F11 Antibody
MBS9509374-01 0.05 mL

Cytochrome P450 4F11 Antibody

Sign In for Pricing
View Details
Cytochrome P450 4F11 Antibody
MBS9509374-02 0.1 mL

Cytochrome P450 4F11 Antibody

Sign In for Pricing
View Details
Cytochrome P450 4F11 Antibody
MBS9509374-03 5x 0.1 mL

Cytochrome P450 4F11 Antibody

Sign In for Pricing
View Details