Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Parathyroid hormone (Pth)

Recombinant Rat Parathyroid hormone (Pth) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Parathyroid hormone (Pth) . Accession Number: P04089; Pth. Expression Region: 32-115aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 16.9kda. Target Synonyms: Parathyrin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Parathyroid hormone (Pth) is a purified Recombinant Protein.

Accession Number

P04089; Pth

Expression Region

32-115aa

Host

E. coli

Target

Parathyroid hormone (Pth)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Parathyrin

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHA4 (Pleckstrin Homology Domain Containing, Family A (Phosphoinositide Binding Specific) Member 4, PEPP1)
250210 50 µL

PLEKHA4 (Pleckstrin Homology Domain Containing, Family A (Phosphoinositide Binding Specific) Member 4, PEPP1)

Sign In for Pricing
View Details
Memo1 Rat siRNA Oligo Duplex (Locus ID 298787)
SR501082 1 Kit

Memo1 Rat siRNA Oligo Duplex (Locus ID 298787)

Sign In for Pricing
View Details
Vmn1r129 AAV Vector (Mouse) (CMV)
49547104 1 µg

Vmn1r129 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
T2R50 Polyclonal Antibody
UB-GEN-7391 100 µL

T2R50 Polyclonal Antibody

Sign In for Pricing
View Details
Aldh9a1 (BC003297) Mouse Tagged ORF Clone
MG207926 10 µg

Aldh9a1 (BC003297) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
p53 Antibody
AF6744-01 100 µL

p53 Antibody

Sign In for Pricing
View Details