Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Parathyroid hormone (Pth)

Recombinant Rat Parathyroid hormone (Pth) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Parathyroid hormone (Pth) . Accession Number: P04089; Pth. Expression Region: 32-115aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 16.9kda. Target Synonyms: Parathyrin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Parathyroid hormone (Pth) is a purified Recombinant Protein.

Accession Number

P04089; Pth

Expression Region

32-115aa

Host

E. coli

Target

Parathyroid hormone (Pth)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Parathyrin

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Galectin-3 ELISA Kit
E28L0328 96 Tests

Human Galectin-3 ELISA Kit

Sign In for Pricing
View Details
TGM4 Antibody, FITC conjugated
A36517-100UG 100 µg

TGM4 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human Filamin B Beta (FLNb) ELISA Kit
RD-FLNb-Hu-48Tests 48 Tests

Human Filamin B Beta (FLNb) ELISA Kit

Sign In for Pricing
View Details
ATP6AP2 Antibody - middle region
ARP79416_P050-25UL 25 µL

ATP6AP2 Antibody - middle region

Sign In for Pricing
View Details
TRMT10A Antibody - middle region
ARP79080_P050-25UL 25 µL

TRMT10A Antibody - middle region

Sign In for Pricing
View Details
Lentiviral mouse Gdf3 shRNA (UAS) - Lentiviral mouse Gdf3 shRNA (UAS, RFP) plasmid
GTR15294988 1 Vial

Lentiviral mouse Gdf3 shRNA (UAS) - Lentiviral mouse Gdf3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details