Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ)

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 14-3-3 protein zeta/delta (YWHAZ) . Accession Number: P63104; YWHAZ. Expression Region: 1-245aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 29.2kda. Target Synonyms: Protein kinase C inhibitor protein 1; KCIP-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein.

Accession Number

P63104; YWHAZ

Expression Region

1-245aa

Host

Yeast

Target

14-3-3 protein zeta/delta (YWHAZ)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein kinase C inhibitor protein 1; KCIP-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin light chain (phospho S20) Polyclonal Antibody, APC-Cy7 Conjugated
bs-7052R-APC-Cy7 100 µL

Myosin light chain (phospho S20) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
LYRIC Rabbit Monoclonal Antibody
E56G2346 100 µL

LYRIC Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD4 Blocking Peptide
CBP1179-01 1 mg

CD4 Blocking Peptide

Sign In for Pricing
View Details
CD4 Blocking Peptide
CBP1179-02 5 mg

CD4 Blocking Peptide

Sign In for Pricing
View Details
Plectin Antibody, mAb, Rabbit
A02528-50 50 µL

Plectin Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Mouse Kdm3b qPCR Primer Pair
QM69454S 200 Tests

Mouse Kdm3b qPCR Primer Pair

Sign In for Pricing
View Details