Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ)

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 14-3-3 protein zeta/delta (YWHAZ) . Accession Number: P63104; YWHAZ. Expression Region: 1-245aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 29.2kda. Target Synonyms: Protein kinase C inhibitor protein 1; KCIP-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein.

Accession Number

P63104; YWHAZ

Expression Region

1-245aa

Host

Yeast

Target

14-3-3 protein zeta/delta (YWHAZ)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein kinase C inhibitor protein 1; KCIP-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPNE6 siRNA (Mouse)
CRM0820-01 15 nmol

CPNE6 siRNA (Mouse)

Sign In for Pricing
View Details
CPNE6 siRNA (Mouse)
CRM0820-02 30 nmol

CPNE6 siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant Clostridium Phytofermentans glmM Protein (aa 1-448)
VAng-Lsx01319-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Phytofermentans glmM Protein (aa 1-448)

Sign In for Pricing
View Details
PLD1 Rabbit pAb
A15081 1000 μL

PLD1 Rabbit pAb

Sign In for Pricing
View Details
PRPSAP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]
TA501563AM 100 µL

PRPSAP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]

Sign In for Pricing
View Details
Canine Monofunctional C1-tetrahydrofolate synthase, mitochondrial (MTHFD1L) ELISA Kit
MBS2604640-01 48 Well

Canine Monofunctional C1-tetrahydrofolate synthase, mitochondrial (MTHFD1L) ELISA Kit

Sign In for Pricing
View Details