Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ)

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 14-3-3 protein zeta/delta (YWHAZ) . Accession Number: P63104; YWHAZ. Expression Region: 1-245aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 29.2kda. Target Synonyms: Protein kinase C inhibitor protein 1; KCIP-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein.

Accession Number

P63104; YWHAZ

Expression Region

1-245aa

Host

Yeast

Target

14-3-3 protein zeta/delta (YWHAZ)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein kinase C inhibitor protein 1; KCIP-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arhgap10 Mouse shRNA Plasmid (Locus ID 78514)
TL517040 1 Kit

Arhgap10 Mouse shRNA Plasmid (Locus ID 78514)

Sign In for Pricing
View Details
COL6A5 Peptide - C-terminal region
MBS3242232-01 0.1 mg

COL6A5 Peptide - C-terminal region

Sign In for Pricing
View Details
COL6A5 Peptide - C-terminal region
MBS3242232-02 5x 0.1 mg

COL6A5 Peptide - C-terminal region

Sign In for Pricing
View Details
Goat Polyclonal to Human DCYTB / CYBRD1
MBS247719-01 0.05 mg

Goat Polyclonal to Human DCYTB / CYBRD1

Sign In for Pricing
View Details
Goat Polyclonal to Human DCYTB / CYBRD1
MBS247719-02 5x 0.0 5mg

Goat Polyclonal to Human DCYTB / CYBRD1

Sign In for Pricing
View Details
LONRF3 CRISPR Activation Plasmid (m)
sc-428857-ACT 20 µg

LONRF3 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details