Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ)

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 14-3-3 protein zeta/delta (YWHAZ) . Accession Number: P63104; YWHAZ. Expression Region: 1-245aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 29.2kda. Target Synonyms: Protein kinase C inhibitor protein 1; KCIP-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein.

Accession Number

P63104; YWHAZ

Expression Region

1-245aa

Host

Yeast

Target

14-3-3 protein zeta/delta (YWHAZ)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein kinase C inhibitor protein 1; KCIP-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEURL4 Lentiviral Activation Particles (h2)
sc-407452-LAC-2 200 µL

NEURL4 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Rabbit Glutathione S Transferase Kappa 1 (GSTK1) ELISA Kit
abx362448 96 Well

Rabbit Glutathione S Transferase Kappa 1 (GSTK1) ELISA Kit

Sign In for Pricing
View Details
Dual Specificity Protein Kinase CLK2 (CLK2) Antibody
abx033456-01 80 µL

Dual Specificity Protein Kinase CLK2 (CLK2) Antibody

Sign In for Pricing
View Details
Dual Specificity Protein Kinase CLK2 (CLK2) Antibody
abx033456-02 400 µL

Dual Specificity Protein Kinase CLK2 (CLK2) Antibody

Sign In for Pricing
View Details
Orange RNA Lysis Kit 50
ORANGEE1-RNA 50 Preparations

Orange RNA Lysis Kit 50

Sign In for Pricing
View Details
STRA6 AAV Vector (Rat) (CMV)
45769106 1 µg

STRA6 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details