Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ)

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 14-3-3 protein zeta/delta (YWHAZ) . Accession Number: P63104; YWHAZ. Expression Region: 1-245aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 29.2kda. Target Synonyms: Protein kinase C inhibitor protein 1; KCIP-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein.

Accession Number

P63104; YWHAZ

Expression Region

1-245aa

Host

Yeast

Target

14-3-3 protein zeta/delta (YWHAZ)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein kinase C inhibitor protein 1; KCIP-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Thyroid Ab ELISA Kit
ELA-E0844r 96 Tests

Rat Thyroid Ab ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD24 Antibody (ML5) [FITC]
NB100-77903F 0.1 mL

Mouse Monoclonal CD24 Antibody (ML5) [FITC]

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor C (VEGFC) BioAssayTM ELISA Kit (Bovine) discontinued
028843-01 48 Tests

Vascular Endothelial Growth Factor C (VEGFC) BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor C (VEGFC) BioAssayTM ELISA Kit (Bovine) discontinued
028843-02 96 Tests

Vascular Endothelial Growth Factor C (VEGFC) BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details
MCAM sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1277307 1.0 µg DNA

MCAM sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Monoclonal SARA2 / SAR1B Antibody (clone AT1C7), Clone: AT1C7
AMM07713G 0.05ml

Monoclonal SARA2 / SAR1B Antibody (clone AT1C7), Clone: AT1C7

Sign In for Pricing
View Details