Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ)

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: 14-3-3 protein zeta/delta (YWHAZ) . Accession Number: P63104; YWHAZ. Expression Region: 1-245aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 29.2kda. Target Synonyms: Protein kinase C inhibitor protein 1; KCIP-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) is a purified Recombinant Protein.

Accession Number

P63104; YWHAZ

Expression Region

1-245aa

Host

Yeast

Target

14-3-3 protein zeta/delta (YWHAZ)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein kinase C inhibitor protein 1; KCIP-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFNE qPCR Primer Pair
QH72497S 200 Tests

Human IFNE qPCR Primer Pair

Sign In for Pricing
View Details
Nek6 (NM_182953) Rat Untagged Clone
RN215322 10 µg

Nek6 (NM_182953) Rat Untagged Clone

Sign In for Pricing
View Details
C-Type Natriuretic Peptide (CNP) (1-22), human TFA 0.5mg
A22771-0.5 0.5 mg

C-Type Natriuretic Peptide (CNP) (1-22), human TFA 0.5mg

Sign In for Pricing
View Details
MARCHF5 Human Gene Knockout Kit (CRISPR)
KN415645 1 Kit

MARCHF5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FRAT1 Protein Vector (Mouse) (pPB-N-His)
PV180271 500 ng

FRAT1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4) ELISA Kit
RDR-UBR4-Hu-01 96 Tests

Human Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4) ELISA Kit

Sign In for Pricing
View Details