Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1)

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Stromal cell-derived factor 2-like protein 1 (Sdf2l1) . Accession Number: Q9ESP1; Sdf2l1. Expression Region: 29-211aa. Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.4kda. Target Synonyms: Sdf2l1; Stromal cell-derived factor 2-like protein 1; SDF2-like protein 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) is a purified Recombinant Protein.

Accession Number

Q9ESP1; Sdf2l1

Expression Region

29-211aa

Host

Yeast

Target

Stromal cell-derived factor 2-like protein 1 (Sdf2l1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Sdf2l1; Stromal cell-derived factor 2-like protein 1; SDF2-like protein 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D9Ertd402e sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4285503 1.0 µg DNA

D9Ertd402e sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
HBe Antigen
orb98865 1 mg

HBe Antigen

Sign In for Pricing
View Details
Lentiviral human AGBL2 shRNA (UAS) - Lentiviral human AGBL2 shRNA (UAS, GFP) (100)
GTR15334716 1 Vial

Lentiviral human AGBL2 shRNA (UAS) - Lentiviral human AGBL2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Polr3k Mouse siRNA Oligo Duplex (Locus ID 67005)
SR401357 1 Kit

Polr3k Mouse siRNA Oligo Duplex (Locus ID 67005)

Sign In for Pricing
View Details
CADM1 CRISPR Knock Out 293T Cell Line (Human)
14909141 1x 10^6 Cells / 1.0 mL

CADM1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Sestrin 1 (Sestrin-1, SESN1, SEST1, p53-regulated Protein PA26, PA26) (HRP)
133203-HRP 100 µL

Sestrin 1 (Sestrin-1, SESN1, SEST1, p53-regulated Protein PA26, PA26) (HRP)

Sign In for Pricing
View Details