Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1)

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Stromal cell-derived factor 2-like protein 1 (Sdf2l1) . Accession Number: Q9ESP1; Sdf2l1. Expression Region: 29-211aa. Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.4kda. Target Synonyms: Sdf2l1; Stromal cell-derived factor 2-like protein 1; SDF2-like protein 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) is a purified Recombinant Protein.

Accession Number

Q9ESP1; Sdf2l1

Expression Region

29-211aa

Host

Yeast

Target

Stromal cell-derived factor 2-like protein 1 (Sdf2l1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Sdf2l1; Stromal cell-derived factor 2-like protein 1; SDF2-like protein 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Activin Receptor Type IA  (2D5)
YF-MA11817 100 ug

Anti-Activin Receptor Type IA (2D5)

Sign In for Pricing
View Details
Rabbit Polyclonal CCNY Antibody
NBP3-30700 100 µg

Rabbit Polyclonal CCNY Antibody

Sign In for Pricing
View Details
OR56A3 Protein Vector (Human) (pPM-C-HA)
PV107704 500 ng

OR56A3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DR4, NT (TRAIL R1, TRAIL Receptor1, Death Receptor4) (MaxLight 490)
D9300-33-ML490 100 µL

DR4, NT (TRAIL R1, TRAIL Receptor1, Death Receptor4) (MaxLight 490)

Sign In for Pricing
View Details
Fibrillarin Rabbit mAb
C06522-100uL 100 µL

Fibrillarin Rabbit mAb

Sign In for Pricing
View Details
CHRNE Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
16135061 1.0 µg DNA

CHRNE Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details