Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1)

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Stromal cell-derived factor 2-like protein 1 (Sdf2l1) . Accession Number: Q9ESP1; Sdf2l1. Expression Region: 29-211aa. Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.4kda. Target Synonyms: Sdf2l1; Stromal cell-derived factor 2-like protein 1; SDF2-like protein 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) is a purified Recombinant Protein.

Accession Number

Q9ESP1; Sdf2l1

Expression Region

29-211aa

Host

Yeast

Target

Stromal cell-derived factor 2-like protein 1 (Sdf2l1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Sdf2l1; Stromal cell-derived factor 2-like protein 1; SDF2-like protein 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgf3 Peptide - C-terminal region
MBS3231219-01 0.1 mg

Fgf3 Peptide - C-terminal region

Sign In for Pricing
View Details
Fgf3 Peptide - C-terminal region
MBS3231219-02 5x 0.1 mg

Fgf3 Peptide - C-terminal region

Sign In for Pricing
View Details
RPL7P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1888805 3x 1.0 µg

RPL7P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CPT1-C (B-1) P
sc-514555 P 100 µg - 0.5 mL

CPT1-C (B-1) P

Sign In for Pricing
View Details
β3 Tubulin (2G10) Alexa Fluor® 790
sc-80005 AF790 200 µg/mL

β3 Tubulin (2G10) Alexa Fluor® 790

Sign In for Pricing
View Details
SIRT2 (5Q1) Rabbit Monoclonal Antibody
E28M0497 100 µL

SIRT2 (5Q1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details