Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage migration inhibitory factor (Mif)

Recombinant Mouse Macrophage migration inhibitory factor (Mif) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Macrophage migration inhibitory factor (Mif) . Accession Number: P34884; Mif. Expression Region: 2-115aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 13.9kda. Target Synonyms: Delayed early response protein 6; DER6; Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase (EC:5.3.3.12) ; Phenylpyruvate tautomerase; MIF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Macrophage migration inhibitory factor (Mif) is a purified Recombinant Protein.

Accession Number

P34884; Mif

Expression Region

2-115aa

Host

Yeast

Target

Macrophage migration inhibitory factor (Mif)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Delayed early response protein 6; DER6; Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase (EC:5.3.3.12) ; Phenylpyruvate tautomerase; MIF

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WTIP / Wilms Tumor Protein 1-Interacting Protein Recombinant Protein
MBS2903145 Inquire

Human WTIP / Wilms Tumor Protein 1-Interacting Protein Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse IgG1Fc protein, No tag
IMP-1112 10 µg

Recombinant Mouse IgG1Fc protein, No tag

Sign In for Pricing
View Details
PAK4 Rabbit pAb
A11646-01 20 µL

PAK4 Rabbit pAb

Sign In for Pricing
View Details
PAK4 Rabbit pAb
A11646-02 100 μL

PAK4 Rabbit pAb

Sign In for Pricing
View Details
PAK4 Rabbit pAb
A11646-03 500 μL

PAK4 Rabbit pAb

Sign In for Pricing
View Details
PAK4 Rabbit pAb
A11646-04 1000 μL

PAK4 Rabbit pAb

Sign In for Pricing
View Details