Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Telomerase protein component 1 (TEP1), partial

Recombinant Human Telomerase protein component 1 (TEP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Telomerase protein component 1 (TEP1) . Accession Number: Q99973; TEP1. Expression Region: 2-226aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 28.8kda. Target Synonyms: Telomerase-associated protein 1; Telomerase protein 1p240p80 telomerase homolog Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Telomerase protein component 1 (TEP1), partial is a purified Recombinant Protein.

Accession Number

Q99973; TEP1

Expression Region

2-226aa

Host

E. coli

Target

Telomerase protein component 1 (TEP1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Telomerase-associated protein 1; Telomerase protein 1p240p80 telomerase homolog

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

EKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKTMEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKSTVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISATETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Linear PBT Trimer
TRC-H493640-50MG 50 mg

Linear PBT Trimer

Sign In for Pricing
View Details
CLPX Rabbit Monoclonal Antibody [Clone ID: 24GB5980]
TA424665 100 µL

CLPX Rabbit Monoclonal Antibody [Clone ID: 24GB5980]

Sign In for Pricing
View Details
LC3B Antibody (MAP1LC3B)
F46115-0.4ML 0.4 mL

LC3B Antibody (MAP1LC3B)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3227), CF488A conjugate, 0.1mg/mL
BNC883227-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3227), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
delta Sarcoglycan (SGCD) Mouse Monoclonal Antibody [Clone ID: AT19G8]
AM50079PU-S 50 µL

delta Sarcoglycan (SGCD) Mouse Monoclonal Antibody [Clone ID: AT19G8]

Sign In for Pricing
View Details
NABP1 Mouse Monoclonal Antibody [Clone ID: OTI7D9]
CF811089 100 µg

NABP1 Mouse Monoclonal Antibody [Clone ID: OTI7D9]

Sign In for Pricing
View Details