Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial

Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) . Target Name: Vacuolating cytotoxin autotransporter (vacA) . Accession Number: P55981; vacA. Expression Region: 37-245aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 26.6kda. Target Synonyms: vacA; HP_0887; Vacuolating cytotoxin autotransporter Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial is a purified Recombinant Protein.

Accession Number

P55981; vacA

Expression Region

37-245aa

Host

E. coli

Target

Vacuolating cytotoxin autotransporter (vacA)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

VacA; HP_0887; Vacuolating cytotoxin autotransporter

Species

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Protein Name

Recombinant Protein

AA Sequence

TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
BNC940633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF488A conjugate, 0.1mg/mL
BNC880807-500 1x 500 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF640R conjugate, 0.1mg/mL
BNC402342-500 1x 500 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details