Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COMM domain-containing protein 4 (COMMD4), partial

Recombinant Human COMM domain-containing protein 4 (COMMD4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COMM domain-containing protein 4 (COMMD4) . Accession Number: Q9H0A8; COMMD4. Expression Region: 1-195aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 48.4kda. Target Synonyms: COMD4_HUMAN; COMM domain containing 4; COMM domain-containing protein 4; COMMD4 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human COMM domain-containing protein 4 (COMMD4), partial is a purified Recombinant Protein.

Accession Number

Q9H0A8; COMMD4

Expression Region

1-195aa

Host

E. coli

Target

COMM domain-containing protein 4 (COMMD4)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

COMD4_HUMAN; COMM domain containing 4; COMM domain-containing protein 4; COMMD4

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAGE5 Antibody
ABD9265 100 µg

BAGE5 Antibody

Sign In for Pricing
View Details
DLX4 Rabbit Polyclonal Antibody
TA312465 100 µL

DLX4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PROX1, CT (Prospero Homeobox Protein 1, Homeobox Prospero-like Protein PROX1, PROX-1) (Biotin) discontinued
P9130-01B-Biotin 200 µL

PROX1, CT (Prospero Homeobox Protein 1, Homeobox Prospero-like Protein PROX1, PROX-1) (Biotin) discontinued

Sign In for Pricing
View Details
Human DNA Repair Protein RAD50 (RAD50) CLIA Kit
abx495821-01 96 Tests

Human DNA Repair Protein RAD50 (RAD50) CLIA Kit

Sign In for Pricing
View Details
Human DNA Repair Protein RAD50 (RAD50) CLIA Kit
abx495821-02 5x 96 Tests

Human DNA Repair Protein RAD50 (RAD50) CLIA Kit

Sign In for Pricing
View Details
Human DNA Repair Protein RAD50 (RAD50) CLIA Kit
abx495821-03 10x 96 Tests

Human DNA Repair Protein RAD50 (RAD50) CLIA Kit

Sign In for Pricing
View Details