Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual specificity protein phosphatase 26 (DUSP26)

Recombinant Human Dual specificity protein phosphatase 26 (DUSP26) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Dual specificity protein phosphatase 26 (DUSP26) . Accession Number: Q9BV47; DUSP26. Expression Region: 1-211aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 39.9kda. Target Synonyms: Dual specificity phosphatase SKRP3Low-molecular-mass dual-specificity phosphatase 4; DSP-4; LDP-4Mitogen-activated protein kinase phosphatase 8; MAP kinase phosphatase 8; MKP-8Novel amplified gene in thyroid anaplastic cancer Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Dual specificity protein phosphatase 26 (DUSP26) is a purified Recombinant Protein.

Accession Number

Q9BV47; DUSP26

Expression Region

1-211aa

Host

E. coli

Target

Dual specificity protein phosphatase 26 (DUSP26)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Dual specificity phosphatase SKRP3Low-molecular-mass dual-specificity phosphatase 4; DSP-4; LDP-4Mitogen-activated protein kinase phosphatase 8; MAP kinase phosphatase 8; MKP-8Novel amplified gene in thyroid anaplastic cancer

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NKX2-1, NT (NKX2-1, NKX2A, TITF1, TTF1, Homeobox protein Nkx-2.1, Homeobox protein NK-2 homolog A, Thyroid nuclear factor 1, Thyroid transcription factor 1) (AP)
MBS6325543-01 0.2 mL

NKX2-1, NT (NKX2-1, NKX2A, TITF1, TTF1, Homeobox protein Nkx-2.1, Homeobox protein NK-2 homolog A, Thyroid nuclear factor 1, Thyroid transcription factor 1) (AP)

Ask
View Details
NKX2-1, NT (NKX2-1, NKX2A, TITF1, TTF1, Homeobox protein Nkx-2.1, Homeobox protein NK-2 homolog A, Thyroid nuclear factor 1, Thyroid transcription factor 1) (AP)
MBS6325543-02 5x 0.2 mL

NKX2-1, NT (NKX2-1, NKX2A, TITF1, TTF1, Homeobox protein Nkx-2.1, Homeobox protein NK-2 homolog A, Thyroid nuclear factor 1, Thyroid transcription factor 1) (AP)

Ask
View Details
Rabbit Polyclonal EYA1 Antibody
NBP1-98347 100 µL

Rabbit Polyclonal EYA1 Antibody

Ask
View Details
Rabbit Polyclonal PSG4 Antibody [Alexa Fluor 700]
NBP3-05801AF700 0.1 mL

Rabbit Polyclonal PSG4 Antibody [Alexa Fluor 700]

Ask
View Details
CD48 (156-4H9), CF647 conjugate, 0.1mg/mL
BNC470307-100 1x 100 µL

CD48 (156-4H9), CF647 conjugate, 0.1mg/mL

Ask
View Details