Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Programmed cell death protein 10 (PDCD10)

Recombinant Human Programmed cell death protein 10 (PDCD10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Programmed cell death protein 10 (PDCD10) . Accession Number: Q9BUL8; PDCD10. Expression Region: 1-212aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 40.7kda. Target Synonyms: Cerebral cavernous malformations 3 protein; TF-1 cell apoptosis-related protein 15 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Programmed cell death protein 10 (PDCD10) is a purified Recombinant Protein.

Accession Number

Q9BUL8; PDCD10

Expression Region

1-212aa

Host

E. coli

Target

Programmed cell death protein 10 (PDCD10)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cerebral cavernous malformations 3 protein; TF-1 cell apoptosis-related protein 15

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Pulmonary surfactant-associated protein D ELISA Kit
EK2613 Inquire

Pig Pulmonary surfactant-associated protein D ELISA Kit

Sign In for Pricing
View Details
HRK Rabbit Polyclonal Antibody
E28PN2258 100 µL

HRK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ACSBG1 Antibody
NBP2-97178-100ul 100 µL

Rabbit Polyclonal ACSBG1 Antibody

Sign In for Pricing
View Details
MYL9, CT (MYL9, MLC2, MRLC1, MYRL2, Myosin regulatory light polypeptide 9, 20kD myosin light chain, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1) (PE)
MBS6323373-01 0.2 mL

MYL9, CT (MYL9, MLC2, MRLC1, MYRL2, Myosin regulatory light polypeptide 9, 20kD myosin light chain, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1) (PE)

Sign In for Pricing
View Details
MYL9, CT (MYL9, MLC2, MRLC1, MYRL2, Myosin regulatory light polypeptide 9, 20kD myosin light chain, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1) (PE)
MBS6323373-02 5x 0.2 mL

MYL9, CT (MYL9, MLC2, MRLC1, MYRL2, Myosin regulatory light polypeptide 9, 20kD myosin light chain, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1) (PE)

Sign In for Pricing
View Details
NDN Protein Vector (Human) (pPB-N-His)
PV027854 500 ng

NDN Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details