Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Resistin-like beta (RETNLB)

Recombinant Human Resistin-like beta (RETNLB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Resistin-like beta (RETNLB) . Accession Number: Q9BQ08; RETNLB. Expression Region: 24-111aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 13.4kda. Target Synonyms: Colon and small intestine-specific cysteine-rich protein Colon carcinoma-related gene protein Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 RELMbeta Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Resistin-like beta (RETNLB) is a purified Recombinant Protein.

Accession Number

Q9BQ08; RETNLB

Expression Region

24-111aa

Host

E. coli

Target

Resistin-like beta (RETNLB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Colon and small intestine-specific cysteine-rich protein Colon carcinoma-related gene protein Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 RELMbeta

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2CD2 Adenovirus (Mouse)
14383054 1.0 mL

C2CD2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)
MBS2145210-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)
MBS2145210-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)
MBS2145210-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)
MBS2145210-04 1 mL

Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)
MBS2145210-05 5 mL

Cy3-Linked Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)

Sign In for Pricing
View Details