Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor susceptibility gene 101 protein (TSG101), partial

Recombinant Human Tumor susceptibility gene 101 protein (TSG101), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Tumor susceptibility gene 101 protein (TSG101) . Accession Number: Q99816; TSG101. Expression Region: 1-145aa. Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. Theoretical MW: 36.6kda. Target Synonyms: ESCRT-I complex subunit TSG101 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor susceptibility gene 101 protein (TSG101), partial is a purified Recombinant Protein.

Accession Number

Q99816; TSG101

Expression Region

1-145aa

Host

E. coli

Target

Tumor susceptibility gene 101 protein (TSG101)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-SUMO-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ESCRT-I complex subunit TSG101

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51S1 Human qPCR Primer Pair (NM_001004758)
HP201496 200 Reactions

OR51S1 Human qPCR Primer Pair (NM_001004758)

Sign In for Pricing
View Details
Angiopoietin-1 BioAssayTM ELISA Kit, Human
143714 96 Tests

Angiopoietin-1 BioAssayTM ELISA Kit, Human

Sign In for Pricing
View Details
Lentiviral mouse Son shRNA (UAS) - Lentiviral mouse Son shRNA (UAS, iRFP) plasmid
GTR15198844 1 Vial

Lentiviral mouse Son shRNA (UAS) - Lentiviral mouse Son shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Eco AluRack 7 boxes, 40mm, 305x140x140mm, B10
TE11431B10 1 Piece

Eco AluRack 7 boxes, 40mm, 305x140x140mm, B10

Sign In for Pricing
View Details
Chicken Cholesteryl Ester Transfer Protein ELISA Kit
MBS740490-01 48 Well

Chicken Cholesteryl Ester Transfer Protein ELISA Kit

Sign In for Pricing
View Details
Chicken Cholesteryl Ester Transfer Protein ELISA Kit
MBS740490-02 96 Well

Chicken Cholesteryl Ester Transfer Protein ELISA Kit

Sign In for Pricing
View Details