Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystathionine beta-synthase (Cbs)

Recombinant Mouse Cystathionine beta-synthase (Cbs) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cystathionine beta-synthase (Cbs) . Accession Number: Q91WT9; Cbs. Expression Region: 2-561aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 65.4kda. Target Synonyms: Beta-thionase Serine sulfhydrase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Cystathionine beta-synthase (Cbs) is a purified Recombinant Protein.

Accession Number

Q91WT9; Cbs

Expression Region

2-561aa

Host

E. coli

Target

Cystathionine beta-synthase (Cbs)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

65.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-thionase Serine sulfhydrase

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITM1 (NM_203402) Human Tagged ORF Clone Lentiviral Particle
RC213367L2V 200 µL

FITM1 (NM_203402) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Aurora A+B+C Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-2751R-APC-Cy5.5 100 µL

Aurora A+B+C Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
CD99L2, ID (CD99L2, MIC2L1, CD99 antigen-like protein 2, MIC2-like protein 1, CD99)
033558 200 µL

CD99L2, ID (CD99L2, MIC2L1, CD99 antigen-like protein 2, MIC2-like protein 1, CD99)

Sign In for Pricing
View Details
25-Hydroxyvitamin D2 3-Hemisuccinate
H995770 10 mg

25-Hydroxyvitamin D2 3-Hemisuccinate

Sign In for Pricing
View Details
DNA pol ε A (3C5.1) FITC
sc-12728 FITC 200 µg/mL

DNA pol ε A (3C5.1) FITC

Sign In for Pricing
View Details
ARSI Antibody
E19-3798 100 µg -100 µL

ARSI Antibody

Sign In for Pricing
View Details