Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystathionine beta-synthase (Cbs)

Recombinant Mouse Cystathionine beta-synthase (Cbs) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cystathionine beta-synthase (Cbs) . Accession Number: Q91WT9; Cbs. Expression Region: 2-561aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 65.4kda. Target Synonyms: Beta-thionase Serine sulfhydrase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Cystathionine beta-synthase (Cbs) is a purified Recombinant Protein.

Accession Number

Q91WT9; Cbs

Expression Region

2-561aa

Host

E. coli

Target

Cystathionine beta-synthase (Cbs)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

65.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-thionase Serine sulfhydrase

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse pulmonary activation regulated chemokine (PARC/CCL18) ELISA Kit
GA-E0209MS-01 48 Tests

Mouse pulmonary activation regulated chemokine (PARC/CCL18) ELISA Kit

Sign In for Pricing
View Details
Mouse pulmonary activation regulated chemokine (PARC/CCL18) ELISA Kit
GA-E0209MS-02 96 Tests

Mouse pulmonary activation regulated chemokine (PARC/CCL18) ELISA Kit

Sign In for Pricing
View Details
AMPD3 sgRNA CRISPR Lentivector (Human) (Target 1)
K0082302 1.0 µg DNA

AMPD3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MAPK13 Blocking Peptide
MBS543963-01 0.25 mg

MAPK13 Blocking Peptide

Sign In for Pricing
View Details
MAPK13 Blocking Peptide
MBS543963-02 5x 0.25 mg

MAPK13 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Asparagine--tRNA ligase, cytoplasmic (nrs-1), partial
MBS1443580 Inquire

Recombinant Caenorhabditis elegans Asparagine--tRNA ligase, cytoplasmic (nrs-1), partial

Sign In for Pricing
View Details