Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pan troglodytes (Chimpanzee) . Target Name: Lymphotoxin-beta (LTB) . Accession Number: Q862Z7; LTB. Expression Region: 49-244aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 36.8kda. Target Synonyms: Tumor necrosis factor C; TNF-CTumor necrosis factor ligand superfamily member 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial is a purified Recombinant Protein.

Accession Number

Q862Z7; LTB

Expression Region

49-244aa

Host

E. coli

Target

Lymphotoxin-beta (LTB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Tumor necrosis factor C; TNF-CTumor necrosis factor ligand superfamily member 3

Species

Pan troglodytes (Chimpanzee)

Protein Name

Recombinant Protein

AA Sequence

QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL1 Recombinant Protein
OPCD00928-200UG 200 µg

MRPL1 Recombinant Protein

Sign In for Pricing
View Details
HCRT Human Pre-designed siRNA Set A
HY-RS06050 1 Set

HCRT Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Hu Ig Kappa Light Chain PE-Cy7
MBS1802228-01 100 Tests

Anti-Hu Ig Kappa Light Chain PE-Cy7

Sign In for Pricing
View Details
Anti-Hu Ig Kappa Light Chain PE-Cy7
MBS1802228-02 5x 100 Tests

Anti-Hu Ig Kappa Light Chain PE-Cy7

Sign In for Pricing
View Details
Goat Centromere protein P (CENPP) ELISA Kit
GTR10340010 96 Well

Goat Centromere protein P (CENPP) ELISA Kit

Sign In for Pricing
View Details
Bcl-xL Antibody [D4A3]
C14576-100uL*2 2x 100μL

Bcl-xL Antibody [D4A3]

Sign In for Pricing
View Details