Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Accessory factor US11 (US11)

Recombinant Human herpesvirus 1 Accessory factor US11 (US11) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) . Target Name: herpesvirus 1 Accessory factor US11 (US11) . Accession Number: P04487; US11. Expression Region: 1-161aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 25.2kda. Target Synonyms: Vmw21 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human herpesvirus 1 Accessory factor US11 (US11) is a purified Recombinant Protein.

Accession Number

P04487; US11

Expression Region

1-161aa

Host

E. coli

Target

Herpesvirus 1 Accessory factor US11 (US11)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Vmw21

Species

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Protein Name

Recombinant Protein

AA Sequence

MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Adrenergic Receptor Alpha 2C ELISA Kit
MBS099407-01 48 Well

Porcine Adrenergic Receptor Alpha 2C ELISA Kit

Sign In for Pricing
View Details
Porcine Adrenergic Receptor Alpha 2C ELISA Kit
MBS099407-02 96 Well

Porcine Adrenergic Receptor Alpha 2C ELISA Kit

Sign In for Pricing
View Details
Porcine Adrenergic Receptor Alpha 2C ELISA Kit
MBS099407-03 5x 96 Well

Porcine Adrenergic Receptor Alpha 2C ELISA Kit

Sign In for Pricing
View Details
Porcine Adrenergic Receptor Alpha 2C ELISA Kit
MBS099407-04 10x 96 Well

Porcine Adrenergic Receptor Alpha 2C ELISA Kit

Sign In for Pricing
View Details
ETV5 Antibody
MBS8505228-01 0.1 mg

ETV5 Antibody

Sign In for Pricing
View Details
ETV5 Antibody
MBS8505228-02 0.1 mL (AF405L)

ETV5 Antibody

Sign In for Pricing
View Details