Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Nickel-responsive regulator (nikR)

Recombinant E. coli Nickel-responsive regulator (nikR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Nickel-responsive regulator (nikR) . Accession Number: P0A6Z6; nikR. Expression Region: 1-133aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 19.1kda. Target Synonyms: nikR; yhhG; b3481; JW3446Nickel-responsive regulator Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Nickel-responsive regulator (nikR) is a purified Recombinant Protein.

Accession Number

P0A6Z6; nikR

Expression Region

1-133aa

Host

E. coli

Target

Nickel-responsive regulator (nikR)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

NikR; yhhG; b3481; JW3446Nickel-responsive regulator

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR16 Polyclonal Antibody, PE Conjugated
bs-6750R-PE-TR 20 µL

WDR16 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
C17orf75 (h2) : 293T Lysate
sc-116623 100 µg - 200 µL

C17orf75 (h2) : 293T Lysate

Sign In for Pricing
View Details
FAM186B Human shRNA Plasmid Kit (Locus ID 84070)
TR306252 1 Kit

FAM186B Human shRNA Plasmid Kit (Locus ID 84070)

Sign In for Pricing
View Details
Human CCDC105 activation kit by CRISPRa
GA114945 1 Kit

Human CCDC105 activation kit by CRISPRa

Sign In for Pricing
View Details
USP33 Polyclonal Antibody
MBS2565547-01 0.06 mL

USP33 Polyclonal Antibody

Sign In for Pricing
View Details
USP33 Polyclonal Antibody
MBS2565547-02 0.12 mL

USP33 Polyclonal Antibody

Sign In for Pricing
View Details