Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant SerRatia marcescens DNA-binding protein H-NS (hns)

Recombinant SerRatia marcescens DNA-binding protein H-NS (hns) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Serratia marcescens. Target Name: DNA-binding protein H-NS (hns) . Accession Number: P18955; hns. Expression Region: 2-135aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 19.5kda. Target Synonyms: Histone-like protein HLP-II Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant SerRatia marcescens DNA-binding protein H-NS (hns) is a purified Recombinant Protein.

Accession Number

P18955; hns

Expression Region

2-135aa

Host

E. coli

Target

DNA-binding protein H-NS (hns)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Histone-like protein HLP-II

Species

Serratia marcescens

Protein Name

Recombinant Protein

AA Sequence

SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD82 Rabbit Monoclonal Antibody
TA423255 100 µL

CD82 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
iFluor™ 488 Conjugated Cytokeratin 17 Recombinant Rabbit Monoclonal Antibody [SR45-06]
HA720138F 100 µL

iFluor™ 488 Conjugated Cytokeratin 17 Recombinant Rabbit Monoclonal Antibody [SR45-06]

Sign In for Pricing
View Details
Tkt Mouse Gene Knockout Kit (CRISPR)
KN517603 1 Kit

Tkt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diminazene-13C2,15N4 Dihydrochloride (major)
TRC-D479552-1MG 1 mg

Diminazene-13C2,15N4 Dihydrochloride (major)

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), CF740 conjugate, 0.1mg/mL
BNC741071-500 1x 500 µL

Ksp-Cadherin / CDH16 (CDH16/1071), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NDUFA3 (NM_004542) Human Recombinant Protein
TP761359 50 µg

NDUFA3 (NM_004542) Human Recombinant Protein

Sign In for Pricing
View Details