Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant SerRatia marcescens DNA-binding protein H-NS (hns)

Recombinant SerRatia marcescens DNA-binding protein H-NS (hns) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Serratia marcescens. Target Name: DNA-binding protein H-NS (hns) . Accession Number: P18955; hns. Expression Region: 2-135aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 19.5kda. Target Synonyms: Histone-like protein HLP-II Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant SerRatia marcescens DNA-binding protein H-NS (hns) is a purified Recombinant Protein.

Accession Number

P18955; hns

Expression Region

2-135aa

Host

E. coli

Target

DNA-binding protein H-NS (hns)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Histone-like protein HLP-II

Species

Serratia marcescens

Protein Name

Recombinant Protein

AA Sequence

SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4, Mouse (T-Cell Marker) (GK1.5), CF405S conjugate, 0.1mg/mL
BNC042009-100 1x 100 µL

CD4, Mouse (T-Cell Marker) (GK1.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rcan1 Mouse Gene Knockout Kit (CRISPR)
KN514603 1 Kit

Rcan1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein
TP325196L 1 mg

MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein

Sign In for Pricing
View Details
Uncoated Mouse LEP (Leptin) ELISA Kit
E-UNEL-M0074-01 5x 96 Tests

Uncoated Mouse LEP (Leptin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse LEP (Leptin) ELISA Kit
E-UNEL-M0074-02 15x 96 Tests

Uncoated Mouse LEP (Leptin) ELISA Kit

Sign In for Pricing
View Details
Nile blue A (Technical Grade)
TRC-N464213-1G 1 g

Nile blue A (Technical Grade)

Sign In for Pricing
View Details