Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vascular endothelial growth factor C (Vegfc)

Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Vascular endothelial growth factor C (Vegfc) . Accession Number: P97953; Vegfc. Expression Region: 108-223aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 17kda. Target Synonyms: Flt4 ligand; Flt4-LVascular endothelial growth factor-related protein; VRP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein.

Accession Number

P97953; Vegfc

Expression Region

108-223aa

Host

E. coli

Target

Vascular endothelial growth factor C (Vegfc)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Flt4 ligand; Flt4-LVascular endothelial growth factor-related protein; VRP

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Calbindin D-28K Antibody (FGF2/7364) [Alexa Fluor 594]
NBP3-24173AF594 0.1 mL

Mouse Monoclonal Calbindin D-28K Antibody (FGF2/7364) [Alexa Fluor 594]

Ask
View Details
FITC Conjugated, Anti-CD31 / PECAM-1 Monoclonal Antibody (Clone:MEM-05)
30-1968-100 100 Tests

FITC Conjugated, Anti-CD31 / PECAM-1 Monoclonal Antibody (Clone:MEM-05)

Ask
View Details
AP2B1, ID (AP2B1, ADTB2, CLAPB1, AP-2 complex subunit beta, AP105B, Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, Beta-2-adaptin, Beta-adaptin, Clathrin assembly protein complex 2 beta large chain, Plasma membr
MBS6274076-01 0.1 mL

AP2B1, ID (AP2B1, ADTB2, CLAPB1, AP-2 complex subunit beta, AP105B, Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, Beta-2-adaptin, Beta-adaptin, Clathrin assembly protein complex 2 beta large chain, Plasma membr

Ask
View Details
AP2B1, ID (AP2B1, ADTB2, CLAPB1, AP-2 complex subunit beta, AP105B, Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, Beta-2-adaptin, Beta-adaptin, Clathrin assembly protein complex 2 beta large chain, Plasma membr
MBS6274076-02 5x 0.1 mL

AP2B1, ID (AP2B1, ADTB2, CLAPB1, AP-2 complex subunit beta, AP105B, Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, Beta-2-adaptin, Beta-adaptin, Clathrin assembly protein complex 2 beta large chain, Plasma membr

Ask
View Details
Lentiviral human CGB2 shRNA (UAS) - Lentiviral human CGB2 shRNA (UAS, RFP) plasmid
GTR15164149 1 Vial

Lentiviral human CGB2 shRNA (UAS) - Lentiviral human CGB2 shRNA (UAS, RFP) plasmid

Ask
View Details
6720467C03Rik (BC020162) Mouse Tagged ORF Clone
MR203897 10 µg

6720467C03Rik (BC020162) Mouse Tagged ORF Clone

Ask
View Details