Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vascular endothelial growth factor C (Vegfc)

Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Vascular endothelial growth factor C (Vegfc) . Accession Number: P97953; Vegfc. Expression Region: 108-223aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 17kda. Target Synonyms: Flt4 ligand; Flt4-LVascular endothelial growth factor-related protein; VRP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein.

Accession Number

P97953; Vegfc

Expression Region

108-223aa

Host

E. coli

Target

Vascular endothelial growth factor C (Vegfc)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Flt4 ligand; Flt4-LVascular endothelial growth factor-related protein; VRP

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK1 Recombinant Rabbit mAb, BF488 conjugated
orb2332672 100 µL

MEK1 Recombinant Rabbit mAb, BF488 conjugated

Sign In for Pricing
View Details
Anti-PDCD1/PD-1/CD279 Antibody (Sintilimab)
F1134-1 1 mg

Anti-PDCD1/PD-1/CD279 Antibody (Sintilimab)

Sign In for Pricing
View Details
Otub1 Rat siRNA Oligo Duplex (Locus ID 293705)
SR510617 1 Kit

Otub1 Rat siRNA Oligo Duplex (Locus ID 293705)

Sign In for Pricing
View Details
St3Gal-III Lentiviral Activation Particles (h)
sc-406298-LAC 200 µL

St3Gal-III Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Fam43b Mouse shRNA Plasmid (Locus ID 625638)
TR518203 1 Kit

Fam43b Mouse shRNA Plasmid (Locus ID 625638)

Sign In for Pricing
View Details
IGFBP1 Rabbit Polyclonal Antibody (Fluoro488)
orb3076619 100 µg

IGFBP1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details