Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vascular endothelial growth factor C (Vegfc)

Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Vascular endothelial growth factor C (Vegfc) . Accession Number: P97953; Vegfc. Expression Region: 108-223aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 17kda. Target Synonyms: Flt4 ligand; Flt4-LVascular endothelial growth factor-related protein; VRP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein.

Accession Number

P97953; Vegfc

Expression Region

108-223aa

Host

E. coli

Target

Vascular endothelial growth factor C (Vegfc)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Flt4 ligand; Flt4-LVascular endothelial growth factor-related protein; VRP

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX1 (Sorting Nexin 1, HsT17379, MGC8664, SNX1A, Vps5) (MaxLight 750)
MBS6240686-01 0.1 mL

SNX1 (Sorting Nexin 1, HsT17379, MGC8664, SNX1A, Vps5) (MaxLight 750)

Sign In for Pricing
View Details
SNX1 (Sorting Nexin 1, HsT17379, MGC8664, SNX1A, Vps5) (MaxLight 750)
MBS6240686-02 5x 0.1 mL

SNX1 (Sorting Nexin 1, HsT17379, MGC8664, SNX1A, Vps5) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral human TARBP2 shRNA (UAS) - Lentiviral human TARBP2 shRNA (UAS, RFP) (100)
GTR15338043 1 Vial

Lentiviral human TARBP2 shRNA (UAS) - Lentiviral human TARBP2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Lsm10 shRNA (UAS) - Lentiviral mouse Lsm10 shRNA (UAS, RFP) plasmid
GTR15185017 1 Vial

Lentiviral mouse Lsm10 shRNA (UAS) - Lentiviral mouse Lsm10 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Trastuzumab, Anti Human HER2 mAb, Carrier-free (BSA/Glycerol-free)
AMHE00024L-01 100 µg

Trastuzumab, Anti Human HER2 mAb, Carrier-free (BSA/Glycerol-free)

Sign In for Pricing
View Details
Trastuzumab, Anti Human HER2 mAb, Carrier-free (BSA/Glycerol-free)
AMHE00024L-02 500 µg

Trastuzumab, Anti Human HER2 mAb, Carrier-free (BSA/Glycerol-free)

Sign In for Pricing
View Details