Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vascular endothelial growth factor C (Vegfc)

Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Vascular endothelial growth factor C (Vegfc) . Accession Number: P97953; Vegfc. Expression Region: 108-223aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 17kda. Target Synonyms: Flt4 ligand; Flt4-LVascular endothelial growth factor-related protein; VRP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Vascular endothelial growth factor C (Vegfc) is a purified Recombinant Protein.

Accession Number

P97953; Vegfc

Expression Region

108-223aa

Host

E. coli

Target

Vascular endothelial growth factor C (Vegfc)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Flt4 ligand; Flt4-LVascular endothelial growth factor-related protein; VRP

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ApoL1 Antibody
KC-2489-01 50 μL

ApoL1 Antibody

Sign In for Pricing
View Details
ApoL1 Antibody
KC-2489-02 100 µL

ApoL1 Antibody

Sign In for Pricing
View Details
ApoL1 Antibody
KC-2489-03 1 mL

ApoL1 Antibody

Sign In for Pricing
View Details
OxiSelect BPDE Protein Adduct ELISA Kit
MBS168495-01 96 Assays

OxiSelect BPDE Protein Adduct ELISA Kit

Sign In for Pricing
View Details
OxiSelect BPDE Protein Adduct ELISA Kit
MBS168495-02 5x 96 Assays

OxiSelect BPDE Protein Adduct ELISA Kit

Sign In for Pricing
View Details
SIGLEC1 Recombinant Antibody
bsm-60328R-01 20 µL

SIGLEC1 Recombinant Antibody

Sign In for Pricing
View Details